• Human TGF beta 1 (Transforming growth factor beta 1) His-Tag GMP Grade Recombinant Protein
ENDOTOXIN LEVEL <0.1 EU per 1 μg of the protein by the LAL method. Human Recombinant GMP Grade TGF beta 1 (Transforming growth factor beta 1). Transforming growth factor beta 1 (TGF beta 1) is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, and apoptosis. In humans, TGF-β1 is encoded by the TGFB1 gene.
Product Specifications
Research Area 2D-3D Cell Culture,Cell Therapy
Purity >98% by SDS-PAGE
Target TGF-b1
Tested Applications Cell Culture,Cell Therapy
Conjuation Label His-Tag
Grade GMP Grade
Physical Format Lyophilized
Animal Free Yes
Source(Natural/Synthetic) Recombinant
Origin E.coli
Sterile Sterile
Animal Model Human
Shipping Conditions Blue Ice
Storage Conditions Store at -20degC
Storage Buffer 1X PBS-pH8.0
UniProtKB P01137
Protein Type Bioactive
Technical Notes Protein Sequence - MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVY YVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus
Application Notes BIOACTIVITY-Measure by its ability to inhibit the IL-4 dependent proliferation in HT-2 cells. The ED50 for this effect is <0.1 ng/mL. The specific activity of recombinant human TGF beat 1 is approximately >5 x 107 IU/mg. Measure by its ability to induce proliferation in MCF-7 cells The ED50 for this effect is <3.2 ng/mL.

Note: You will be required to log into your account to send us this request.


Write a review

Please login or register to review

Human TGF beta 1 (Transforming growth factor beta 1) His-Tag GMP Grade Recombinant Protein

  • Brand: Croyez
  • Product Code: Croyez-C01088-GMP-1000
  • Availability: Pre-Order

Available Options


Tags: TGFbeta1, TGF, TGFb1