• Human IL-3 (Interleukin-3) His-Tag GMP Grade Recombinant Protein
ENDOTOXIN LEVEL <0.1 EU per 1 μg of the protein by the LAL method. Human Recombinant GMP Grade IL-3 (Interleukin-3). Interleukin-3 (IL-3) is an interleukin, a type of biological signal (cytokine) that can improve the body's natural response to disease as part of the immune system. It acts by binding to the IL-3 receptor. IL-3 stimulates the differentiation of multipotent hematopoietic stem cells into myeloid progenitor cells or, with the addition of IL-7, into lymphoid progenitor cells. In addition, IL-3 stimulates proliferation of all cells in the myeloid lineage (granulocytes, monocytes, and dendritic cells), in conjunction with other cytokines, e.g., Erythropoietin (EPO), Granulocyte macrophage colony-stimulating factor (GM-CSF), and IL-6. It is secreted by basophils and activated T cells to support growth and differentiation of T cells from the bone marrow in an immune response.
Product Specifications
Research Area 2D-3D Cell Culture,Cell Therapy
Purity >98% by SDS-PAGE
Target IL-3
Tested Applications Cell Culture,Cell Therapy
Conjuation Label His-Tag
Grade GMP Grade
Physical Format Lyophilized
Animal Free Yes
Source(Natural/Synthetic) Recombinant
Origin E.coli
Sterile Sterile
Animal Model Human
Shipping Conditions Blue Ice
Storage Conditions Store at -20degC
Storage Buffer 1X PBS-pH8.0
UniProtKB P08700
Protein Type Bioactive
Technical Notes Protein Sequence - MAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAP TRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF with polyhistidine tag at the C-terminus
Application Notes BIOACTIVITY-Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <0.15 ng/mL. The specific activity of recombinant human IL-3 is approximately >1.2 x 106 IU/mg.

Note: You will be required to log into your account to send us this request.


Write a review

Please login or register to review

Human IL-3 (Interleukin-3) His-Tag GMP Grade Recombinant Protein

  • Brand: Croyez
  • Product Code: Croyez-C01005-GMP-100
  • Availability: Pre-Order

Available Options


Tags: IL3, IL-3