• Human IL-15 (Interleukin-15) His-Tag GMP Grade Recombinant Protein
ENDOTOXIN LEVEL <0.01 EU per 1 μg of the protein by the LAL method. Human Recombinant GMP Grade IL-15 (Interleukin-15). Interleukin-15 (IL-15) is a cytokine with structural similarity to Interleukin-2 (IL-2). Like IL-2, IL-15 binds to and signals through a complex composed of IL-2/IL-15 receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132). IL-15 is secreted by mononuclear phagocytes (and some other cells) following infection by virus(es). This cytokine induces cell proliferation of natural killer cells; cells of the innate immune system whose principal role is to kill virally infected cells.
Product Specifications
Research Area 2D-3D Cell Culture,Cell Therapy
Purity >98% by SDS-PAGE
Target IL-15
Tested Applications Cell Culture,Cell Therapy
Conjuation Label His-Tag
Grade GMP Grade
Physical Format Lyophilized
Animal Free Yes
Source(Natural/Synthetic) Recombinant
Origin E.coli
Sterile Sterile
Animal Model Human
Shipping Conditions Blue Ice
Storage Conditions Store at -20degC
Storage Buffer 1X PBS-pH8.0
UniProtKB P40933
Protein Type Bioactive
Technical Notes Protein Sequence - NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNI KEFLQSFVHIVQMFINTSLE with polyhistidine tag at the N-terminus
Application Notes BIOACTIVITY-Measure by its ability to induce MO7e human megakaryocytic leukemic proliferation. The ED50 for this effect is 0.5-3 ng/mL. The specific activity of recombinant Croyez GMP® human IL-15 is approximately 1.5 x 108 IU/mg.

Note: You will be required to log into your account to send us this request.


Write a review

Please login or register to review

Human IL-15 (Interleukin-15) His-Tag GMP Grade Recombinant Protein

  • Brand: Croyez
  • Product Code: Croyez-C01017-GMP-1000
  • Availability: Pre-Order

Available Options


Tags: IL15, IL-15