ENDOTOXIN LEVEL <0.1 EU per 1 μg of the protein by the LAL method. Human Recombinant GMP Grade EGF (Epidermal growth factor). Epidermal growth factor (EGF) stimulates cell growth and differentiation by binding to its receptor, EGFR. Human EGF is a 6 kDa protein with 53 amino acid residues and three intramolecular disulfide bonds. EGF is present in various body fluids, including blood, milk, urine, saliva, seminal fluid, pancreatic juice, cerebrospinal fluid, and amniotic fluid. Biological activities ascribed to EGF include epithelial development, angiogenesis, inhibition of gastric acid secretion, fibroblast proliferation, and colony formation of epidermal cells in culture.
Product Specifications | |
Research Area | 2D-3D Cell Culture,Cell Therapy |
Purity | >98% by SDS-PAGE |
Target | EGF |
Tested Applications | Cell Culture,Cell Therapy |
Conjuation Label | His-Tag |
Grade | GMP Grade |
Physical Format | Lyophilized |
Animal Free | Yes |
Source(Natural/Synthetic) | Recombinant |
Origin | E.coli |
Sterile | Sterile |
Animal Model | Human |
Shipping Conditions | Blue Ice |
Storage Conditions | Store at -20degC |
Storage Buffer | 1X PBS-pH8.0 |
UniProtKB | P01133 |
Protein Type | Bioactive |
Technical Notes | Protein Sequence - MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRLE with polyhistidine tag at the C-terminus |
Application Notes | BIOACTIVITY-Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 0.05-0.12 ng/mL. The specific activity of recombinant human EGF is approximately >1.4 x 106 IU/mg. |
Human EGF (Epidermal growth factor) His-Tag GMP Grade Recombinant Protein
- Brand: Croyez
- Product Code: Croyez-C01121-GMP-100
- Availability: Pre-Order
Available Options
Tags: Epidermal growth fator, EGF