• Human IL-21 (Interleukin-21) His-Tag GMP Grade Recombinant Protein
ENDOTOXIN LEVEL <0.1 EU per 1 μg of the protein by the LAL method. Human Recombinant GMP Grade IL-21 (Interleukin-21). Interleukin-21 (IL-21) belongs to the IL-15/IL-21 family. It is a cytokine with immunoregulatory activity. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. IL-21 is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. This cytokine induces cell division/proliferation in its target cells.
Product Specifications
Research Area 2D-3D Cell Culture,Cell Therapy
Purity >98% by SDS-PAGE
Target IL-21
Tested Applications Cell Culture,Cell Therapy
Conjuation Label His-Tag
Grade GMP Grade
Physical Format Lyophilized
Animal Free Yes
Source(Natural/Synthetic) Recombinant
Origin E.coli
Sterile Sterile
Animal Model Human
Shipping Conditions Blue Ice
Storage Conditions Store at -20degC
Storage Buffer 1X PBS-pH8.0
UniProtKB Q9HBE4
Protein Type Bioactive
Technical Notes Protein Sequence - MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLT CPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS with polyhistidine tag at the C-terminus
Application Notes BIOACTIVITY-Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED50 for this effect is <10 ng/mL.

Note: You will be required to log into your account to send us this request.


Write a review

Please login or register to review

Human IL-21 (Interleukin-21) His-Tag GMP Grade Recombinant Protein

  • Brand: Croyez
  • Product Code: Croyez-C01026-GMP-100
  • Availability: Pre-Order

Available Options


Tags: IL21, IL-21