• Human IL-18 (Interleukin-18) His-Tag GMP Grade Recombinant Protein
ENDOTOXIN LEVEL <0.1 EU per 1 μg of the protein by the LAL method. Human Recombinant GMP Grade IL-18 (Interleukin-18). Interleukin-18 (IL-18) is a cytokine that belongs to the IL-1 superfamily and is produced by macrophages and other cells. IL-18 works by binding to the IL-18 receptor, and together with IL-12 that it induces cell-mediated immunity following infection with microbial products like lipopolysaccharide (LPS). After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon gamma or type II interferon that plays an important role in activating the macrophages or other cells. The combination of this cytokine and IL-12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production in B cells. IL-18 binding protein (IL-18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity.
Product Specifications
Research Area 2D-3D Cell Culture,Cell Therapy
Purity >98% by SDS-PAGE
Target IL-18
Tested Applications Cell Culture,Cell Therapy
Conjuation Label His-Tag
Grade GMP Grade
Physical Format Lyophilized
Animal Free Yes
Source(Natural/Synthetic) Recombinant
Origin E.coli
Sterile Sterile
Animal Model Human
Shipping Conditions Blue Ice
Storage Conditions Store at -20degC
Storage Buffer 1X PBS-pH8.0
UniProtKB Q14116
Protein Type Bioactive
Technical Notes Protein Sequence - MYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKD TKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED with polyhistidine tag at the C-terminus
Application Notes BIOACTIVITY-Measure by its ability to induce IFN gamma secretion in KG-1 cells. The ED50 for this effect is <6 ng/mL.

Note: You will be required to log into your account to send us this request.


Write a review

Please login or register to review

Human IL-18 (Interleukin-18) His-Tag GMP Grade Recombinant Protein

  • Brand: Croyez
  • Product Code: Croyez-C01023-GMP-1000
  • Availability: Pre-Order

Available Options


Tags: IL18, IL-18