• Human IL-1 beta (Interleukin-1 beta) His-Tag GMP Grade Recombinant Protein
ENDOTOXIN LEVEL <0.1 EU per 1 μg of the protein by the LAL method. Human Recombinant GMP Grade IL-1 beta (Interleukin-1 beta). Interleukin-1 beta (IL-1β) also known as leukocytic pyrogen, leukocytic endogenous mediator, mononuclear cell factor, lymphocyte activating factor and other names, is a cytokine protein that in humans is encoded by the IL1B gene. There are two genes for interleukin-1 (IL-1): IL-1 alpha and IL-1 beta (this gene). IL-1β precursor is cleaved by cytosolic caspase 1 (interleukin-1 beta convertase) to form mature IL-1β.
Product Specifications
Research Area 2D-3D Cell Culture,Cell Therapy
Purity >98% by SDS-PAGE
Target IL-1b
Tested Applications Cell Culture,Cell Therapy
Conjuation Label His-Tag
Grade GMP Grade
Physical Format Lyophilized
Animal Free Yes
Source(Natural/Synthetic) Recombinant
Origin E.coli
Sterile Sterile
Animal Model Human
Shipping Conditions Blue Ice
Storage Conditions Store at -20degC
Storage Buffer 1X PBS-pH8.0
UniProtKB P01584
Protein Type Bioactive
Technical Notes Protein Sequence - MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDP KNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS with polyhistidine tag at the C-terminus
Application Notes BIOACTIVITY-Measure by its ability to induce proliferation in D10.G4.1 cells. The ED50 for this effect is <10 pg/mL. The specific activity of recombinant human IL-1 beta is approximately >1.5 x 108 IU/mg. Measure by its ability to induce IL-8 secretion in HT29 cells. The ED50 for this effect is <2.0 ng/mL.

Note: You will be required to log into your account to send us this request.


Write a review

Please login or register to review

Human IL-1 beta (Interleukin-1 beta) His-Tag GMP Grade Recombinant Protein

  • Brand: Croyez
  • Product Code: Croyez-C01002-GMP-100
  • Availability: Pre-Order

Available Options


Tags: IL1, IL1b, IL1beta