• Human SCF His-Tag GMP Grade Recombinant Protein
ENDOTOXIN LEVEL <0.1 EU per 1 μg of the protein by the LAL method. Human Recombinant GMP Grade SCF. Stem Cell Factor (SCF) is a stromal cell-derived cytokine synthesized by fibroblasts and other cell types. SCF promotes proliferation and early differentiation of cells at the level of multipotential stem cells. SCF is a growth factor important for proliferation, and differentiation of hematopoietic stem cells. One of its roles is to change the BFU-E (burst-forming unit-erythroid) cells, which are the earliest erythrocyte precursors in the erythrocytic series, into the CFU-E (colony-forming unit-erythroid).
Product Specifications
Research Area 2D-3D Cell Culture,Cell Therapy
Purity >98% by SDS-PAGE
Target SCF
Tested Applications Cell Culture,Cell Therapy
Conjuation Label His-Tag
Grade GMP Grade
Physical Format Lyophilized
Animal Free Yes
Source(Natural/Synthetic) Recombinant
Origin E.coli
Sterile Sterile
Animal Model Human
Shipping Conditions Blue Ice
Storage Conditions Store at -20degC
Storage Buffer 1X PBS-pH8.0
UniProtKB P21583
Protein Type Bioactive
Technical Notes Protein Sequence - MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPP SCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA with polyhistidine tag at the C-terminus
Application Notes BIOACTIVITY-Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED50 for this effect is <0.8 ng/mL. The specific activity of recombinant human Flt-3 Ligand is > 1.5 x 106 IU/mg.

Note: You will be required to log into your account to send us this request.


Write a review

Please login or register to review

Human SCF His-Tag GMP Grade Recombinant Protein

  • Brand: Croyez
  • Product Code: Croyez-C01177-GMP-1000
  • Availability: Pre-Order

Available Options


Tags: Stem_Cell_Factor, SCF