• Human Flt-3 Ligand (Fms-related tyrosine kinase 3 ligand) His-Tag GMP Grade Recombinant Protein
ENDOTOXIN LEVEL <0.1 EU per 1 μg of the protein by the LAL method. Human Recombinant GMP Grade Flt-3 Ligand (Fms-related tyrosine kinase 3 ligand). Fms-related tyrosine kinase-3 ligand (Flt-3 Ligand) is a protein which in humans is encoded by the FLT3LG gene. Flt-3 ligand has a tyrosine-protein kinase activity & a growth factor that stimulate the proliferation of hematopoietic progenitor cells of both lymphoid and myeloid origin. Flt3-Ligand synergizes with other CSFs and interleukins to induce growth and differentiation.
Product Specifications
Research Area 2D-3D Cell Culture,Cell Therapy
Purity >98% by SDS-PAGE
Target FLT-3
Tested Applications Cell Culture,Cell Therapy
Conjuation Label His-Tag
Grade GMP Grade
Physical Format Lyophilized
Animal Free Yes
Source(Natural/Synthetic) Recombinant
Origin E.coli
Sterile Sterile
Animal Model Human
Shipping Conditions Blue Ice
Storage Conditions Store at -20degC
Storage Buffer 1X PBS-pH8.0
UniProtKB P49771
Protein Type Bioactive
Technical Notes Protein Sequence - MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPP PSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA with polyhistidine tag at the C-terminus
Application Notes BIOACTIVITY-Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED50 for this effect is <0.8 ng/mL. The specific activity of recombinant human Flt-3 Ligand is > 1.5 x 106 IU/mg.

Note: You will be required to log into your account to send us this request.


Write a review

Please login or register to review

Human Flt-3 Ligand (Fms-related tyrosine kinase 3 ligand) His-Tag GMP Grade Recombinant Protein

  • Brand: Croyez
  • Product Code: Croyez-C01085-GMP-1000
  • Availability: Pre-Order

Available Options


Tags: FLT3, FLT-3