• Human FGF-2 (154 a.a.) (Fibroblast growth factor, basic) His-Tag GMP Grade Recombinant Protein
ENDOTOXIN LEVEL <0.1 EU per 1 μg of the protein by the LAL method. Human Recombinant GMP Grade FGF-2 (154 a.a.) (Fibroblast growth factorbasic). FGF-2, also known as a basic fibroblast growth factor (bFGF) and FGF-β, is a growth factor and signaling protein encoded by the FGF-2 gene. FGF-2 has been shown in preliminary animal studies to protect the heart from injury associated with a heart attack, reducing tissue death and promoting improved function after reperfusion. FGF-2 are also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth, and invasion. Additionally, FGF-2 is frequently used for a critical component of cell culture medium, e.g., human embryonic stem cell culture medium, serum-free culture systems.
Product Specifications
Research Area 2D-3D Cell Culture,Cell Therapy
Purity >98% by SDS-PAGE
Target FGF-2
Tested Applications Cell Culture,Cell Therapy
Conjuation Label His-Tag
Grade GMP Grade
Physical Format Lyophilized
Animal Free Yes
Source(Natural/Synthetic) Recombinant
Origin E.coli
Sterile Sterile
Animal Model Human
Shipping Conditions Blue Ice
Storage Conditions Store at -20degC
Storage Buffer 1X PBS-pH8.0
UniProtKB P09038
Protein Type Bioactive
Technical Notes Protein Sequence - AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMK EDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS with polyhistidine tag at the N-terminus
Application Notes BIOACTIVITY-Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant human FGF-2 is approximately >5 x 105 IU/mg.

Note: You will be required to log into your account to send us this request.


Write a review

Please login or register to review

Human FGF-2 (154 a.a.) (Fibroblast growth factor, basic) His-Tag GMP Grade Recombinant Protein

  • Brand: Croyez
  • Product Code: Croyez-C01092-GMP-1000
  • Availability: Pre-Order

Available Options


Tags: Fibrobast, FGF2, FGF-2